Lineage for d6gn8a_ (6gn8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2333684Protein automated matches [190238] (9 species)
    not a true protein
  7. 2333696Species Human (Homo sapiens) [TaxId:9606] [187008] (43 PDB entries)
  8. 3057974Domain d6gn8a_: 6gn8 A: [358036]
    automated match to d4dnkb_
    complexed with mpd

Details for d6gn8a_

PDB Entry: 6gn8 (more details), 2.34 Å

PDB Description: exoenzyme s from pseudomonas aeruginosa in complex with human 14-3-3 protein beta, trimeric crystal form
PDB Compounds: (A:) 14-3-3 protein beta/alpha

SCOPe Domain Sequences for d6gn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gn8a_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrssw
rvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfyl
kmkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyy
eilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtse

SCOPe Domain Coordinates for d6gn8a_:

Click to download the PDB-style file with coordinates for d6gn8a_.
(The format of our PDB-style files is described here.)

Timeline for d6gn8a_:

  • d6gn8a_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-27