Lineage for d6gkrb_ (6gkr B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (18 species)
    not a true protein
  7. 3057948Species Thermobaculum terrenum [TaxId:525904] [358010] (2 PDB entries)
  8. 3057964Domain d6gkrb_: 6gkr B: [358026]
    automated match to d3u0ga_
    complexed with act, cl, plp

Details for d6gkrb_

PDB Entry: 6gkr (more details), 2.19 Å

PDB Description: crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum in plp-form (holo-form)
PDB Compounds: (B:) branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d6gkrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gkrb_ e.17.1.0 (B:) automated matches {Thermobaculum terrenum [TaxId: 525904]}
enpkylwwnhriipweeatvhltdywwasvtavfegirgywnnaegemyifrledharrl
eqsmqlirmpkeftvdeicqatidlvrandyrgdvyimplayavgnkafsvvgdrttemf
iysrpavsrleedfslhacysswtrinervlpprikalanyrnsqlasseaamngydtal
flnpegkvaegtgscvffvrkgklitpditsgilesitrdtvihlarevlgleveervvd
rtetyladeaflcgthaeitpiasidrhemkhgapgpitrqlrdiyrevvygrdfryrnw
ltpvgmg

SCOPe Domain Coordinates for d6gkrb_:

Click to download the PDB-style file with coordinates for d6gkrb_.
(The format of our PDB-style files is described here.)

Timeline for d6gkrb_:

  • d6gkrb_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-27