Lineage for d6erdd1 (6erd D:44-211)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969011Species Bacillus cereus [TaxId:226900] [358002] (1 PDB entry)
  8. 2969015Domain d6erdd1: 6erd D:44-211 [358003]
    Other proteins in same PDB: d6erda2, d6erdb2, d6erdc2, d6erdd2
    automated match to d5cnpb_
    complexed with cl, gol

Details for d6erdd1

PDB Entry: 6erd (more details), 2 Å

PDB Description: crystal structure of a putative acetyltransferase from bacillus cereus species.
PDB Compounds: (D:) Aminoglycoside N6'-acetyltransferase

SCOPe Domain Sequences for d6erdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6erdd1 d.108.1.0 (D:44-211) automated matches {Bacillus cereus [TaxId: 226900]}
iklesfkksdfkqlinwinseefliqwsgnaftfpldeqqlekyiesantlafkvvdeet
sdvighislgqidninksarigkvlvgntkmrgrsigkhmmkavlhiafdelklhrvtlg
vydfntsaiscyekigfvkegllreskrvgetywnlwemsmleyewkk

SCOPe Domain Coordinates for d6erdd1:

Click to download the PDB-style file with coordinates for d6erdd1.
(The format of our PDB-style files is described here.)

Timeline for d6erdd1: