Lineage for d6erka_ (6erk A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (128 species)
    not a true protein
  7. 3057938Species Psychrobacter cryohalolentis [TaxId:335284] [358000] (1 PDB entry)
  8. 3057939Domain d6erka_: 6erk A: [358001]
    Other proteins in same PDB: d6erkb2
    automated match to d4ah3d_
    complexed with edo, gol, plp, so4

Details for d6erka_

PDB Entry: 6erk (more details), 1.6 Å

PDB Description: crystal structure of diaminopelargonic acid aminotransferase from psychrobacter cryohalolentis
PDB Compounds: (A:) aminotransferase

SCOPe Domain Sequences for d6erka_:

Sequence, based on SEQRES records: (download)

>d6erka_ c.67.1.0 (A:) automated matches {Psychrobacter cryohalolentis [TaxId: 335284]}
mttvstndfdqqhlwhpyaslpptypnividraegiyivtedgtrlidgmsswwasvhgy
nhpklnaamieqlgkmahvmfgglthqpaidlgkkllsivpagldaifyadsgsiaveva
lkmalqyqiaakrpskcqfasthsgyygdtwhamsvcdpingmhslygkqlpmqhfvaap
pmgferdltqserealteffvknsdklagfiiepiiqgaggmrfyspqylqllrklcdey
dvlliadeiatgfgrsgklfacehaaispdimtigkaltggymtfaatlstreiadtisq
sdypalmhgptfmgnplacavacasidlivsydieartenmqaimneqlapavslegvke
vrclgavavielneavdmpifqtllinngiwvrpfgklvyimppyvitddelttlcqall
kvvssyltrk

Sequence, based on observed residues (ATOM records): (download)

>d6erka_ c.67.1.0 (A:) automated matches {Psychrobacter cryohalolentis [TaxId: 335284]}
mttvstndfdqqhlwhpyaslpptypnividraegiyivtedgtrlidgmsswwasvhgy
nhpklnaamieqlgkmahvmfgglthqpaidlgkkllsivpagldaifyadsgsiaveva
lkmalqyqiaakrpskcqfasthsgyygdtwhamsvcdkqlpmqhfvaappmgferdltq
serealteffvknsdklagfiiepiiqgaggmrfyspqylqllrklcdeydvlliadeia
tgfgrsgklfacehaaispdimtigkaltggymtfaatlstreiadtisqsdypalmhgp
tfmgnplacavacasidlivsydieartenmqaimneqlapavslegvkevrclgavavi
elneavdmpifqtllinngiwvrpfgklvyimppyvitddelttlcqallkvvssyltrk

SCOPe Domain Coordinates for d6erka_:

Click to download the PDB-style file with coordinates for d6erka_.
(The format of our PDB-style files is described here.)

Timeline for d6erka_:

  • d6erka_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-27