Lineage for d6e3hb1 (6e3h B:1-174)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (24 species)
    not a true protein
  7. 2592358Species Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [275804] (5 PDB entries)
  8. 3057934Domain d6e3hb1: 6e3h B:1-174 [357996]
    Other proteins in same PDB: d6e3ha1, d6e3ha2, d6e3hb2, d6e3hl1, d6e3hl2
    automated match to d5bnyf_
    complexed with bma, fuc, nag

Details for d6e3hb1

PDB Entry: 6e3h (more details), 2.9 Å

PDB Description: crystal structure of s9-3-37 bound to h5 influenza hemagglutinin
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d6e3hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e3hb1 h.3.1.0 (B:1-174) automated matches {Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis

SCOPe Domain Coordinates for d6e3hb1:

Click to download the PDB-style file with coordinates for d6e3hb1.
(The format of our PDB-style files is described here.)

Timeline for d6e3hb1:

  • d6e3hb1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27