SCOPe 2.08: Domain d6e3ha1: 6e3h A:11-324

Lineage for d6e3ha1 (6e3h A:11-324)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)

8. Domain d6e3ha1: 6e3h A:11-324 [357993]
   Other proteins in same PDB: d6e3ha2, d6e3hb1, d6e3hb2, d6e3hh_, d6e3hl1, d6e3hl2
   automated match to d3m5ja_
   complexed with nag

Details for d6e3ha1

PDB Entry: 6e3h, 2.9 Å

PDB Description: crystal structure of s9-3-37 bound to h5 influenza hemagglutinin

PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d6e3ha1:

Sequence; same for both SEQRES and ATOM records:

>d6e3ha1 b.19.1.0 (A:11-324) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

Timeline for d6e3ha1:

• d6e3ha1 first appeared in SCOPe 2.07