Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries) |
Domain d6e3ha1: 6e3h A:11-324 [357993] Other proteins in same PDB: d6e3ha2, d6e3hb1, d6e3hb2, d6e3hh_, d6e3hl1, d6e3hl2 automated match to d3m5ja_ complexed with nag |
PDB Entry: 6e3h (more details), 2.9 Å
SCOPe Domain Sequences for d6e3ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e3ha1 b.19.1.0 (A:11-324) automated matches {Influenza A virus, different strains [TaxId: 11320]} dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlatglrnsp
Timeline for d6e3ha1: