Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
Protein automated matches [190054] (13 species) not a true protein |
Species Pyrococcus furiosus [TaxId:186497] [279274] (16 PDB entries) |
Domain d6cutb_: 6cut B: [357991] automated match to d1v8zb_ complexed with fej, na |
PDB Entry: 6cut (more details), 1.77 Å
SCOPe Domain Sequences for d6cutb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cutb_ c.79.1.1 (B:) automated matches {Pyrococcus furiosus [TaxId: 186497]} mwfgefggqyvpetlvgplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt ekiggakiylkredlvhggahktnnaigqaplaklmgktrliaetgagqhgvatamagal lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtakdainealrdweatfeyth yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv ndkkvklvgveaggkglesgkhsaslnagqvgvlhgmlsyflqdeegqikpshsiapgld ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem srdeiiivnlsgrgdkdldivlkas
Timeline for d6cutb_: