Lineage for d6d1ra_ (6d1r A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2500239Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2500240Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2500422Family d.14.1.2: RNase P protein [54220] (2 proteins)
    automatically mapped to Pfam PF00825
  6. 3057925Protein automated matches [357987] (1 species)
    not a true protein
  7. 3057926Species Staphylococcus aureus [TaxId:1280] [357988] (1 PDB entry)
  8. 3057927Domain d6d1ra_: 6d1r A: [357989]
    automated match to d1d6ta_

Details for d6d1ra_

PDB Entry: 6d1r (more details), 2 Å

PDB Description: structure of staphylococcus aureus rnase p protein at 2.0 angstrom
PDB Compounds: (A:) Ribonuclease P protein component

SCOPe Domain Sequences for d6d1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d1ra_ d.14.1.2 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
kayrikknadfqriykkghsvanrqfvvytcnnkeidhfrlgisvskklgnavlrnkikr
airenfkvhkshilakdiiviarqpakdmttlqiqnslehvlkiakvfn

SCOPe Domain Coordinates for d6d1ra_:

Click to download the PDB-style file with coordinates for d6d1ra_.
(The format of our PDB-style files is described here.)

Timeline for d6d1ra_:

  • d6d1ra_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-26