Lineage for d6cfna_ (6cfn A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2586782Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 2586864Protein automated matches [190314] (3 species)
    not a true protein
  7. 2586868Species Human (Homo sapiens) [TaxId:9606] [188623] (4 PDB entries)
  8. 3057919Domain d6cfna_: 6cfn A: [357981]
    automated match to d1kb2b_
    complexed with zn

Details for d6cfna_

PDB Entry: 6cfn (more details), 2.5 Å

PDB Description: crystal structure of the dna-free glucocorticoid receptor dna binding domain
PDB Compounds: (A:) Glucocorticoid receptor

SCOPe Domain Sequences for d6cfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cfna_ g.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacry
rkclqagmnlearktkkkik

SCOPe Domain Coordinates for d6cfna_:

Click to download the PDB-style file with coordinates for d6cfna_.
(The format of our PDB-style files is described here.)

Timeline for d6cfna_:

  • d6cfna_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-26