Lineage for d6djlg_ (6djl G:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (139 species)
    not a true protein
  7. 2452278Species Human (Homo sapiens) [TaxId:9606] [186862] (137 PDB entries)
  8. 3057905Domain d6djlg_: 6djl G: [357967]
    automated match to d2bcgy_

Details for d6djlg_

PDB Entry: 6djl (more details), 3.1 Å

PDB Description: crystal structure of the rab11 gef sh3bp5 bound to nucleotide free rab11a
PDB Compounds: (G:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d6djlg_:

Sequence, based on SEQRES records: (download)

>d6djlg_ c.37.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqms

Sequence, based on observed residues (ATOM records): (download)

>d6djlg_ c.37.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnh
lravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqms

SCOPe Domain Coordinates for d6djlg_:

Click to download the PDB-style file with coordinates for d6djlg_.
(The format of our PDB-style files is described here.)

Timeline for d6djlg_:

  • d6djlg_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-27