Lineage for d6b2ka2 (6b2k A:148-221)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316392Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2316654Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2316731Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2316732Protein automated matches [191156] (10 species)
    not a true protein
  7. 2316748Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (24 PDB entries)
  8. 3057898Domain d6b2ka2: 6b2k A:148-221 [357960]
    Other proteins in same PDB: d6b2ka1
    automated match to d2m8pa2
    complexed with cl, iod; mutant

Details for d6b2ka2

PDB Entry: 6b2k (more details), 2 Å

PDB Description: e45a/r132t mutant of hiv-1 capsid protein
PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d6b2ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b2ka2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgv

SCOPe Domain Coordinates for d6b2ka2:

Click to download the PDB-style file with coordinates for d6b2ka2.
(The format of our PDB-style files is described here.)

Timeline for d6b2ka2:

  • d6b2ka2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-26

View in 3D
Domains from same chain:
(mouse over for more information)
d6b2ka1