SCOPe 2.08: Domain d1mrpa_: 1mrp A:

Lineage for d1mrpa_ (1mrp A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Ferric-binding protein FbpA [53867] (7 species)

7. Species Haemophilus influenzae [TaxId:727] [53868] (12 PDB entries)

8. Domain d1mrpa_: 1mrp A: [35796]
   complexed with fe, po4
   has additional insertions and/or extensions that are not grouped together

Details for d1mrpa_

PDB Entry: 1mrp, 1.6 Å

PDB Description: ferric-binding protein from haemophilus influenzae

PDB Compounds: (A:) ferric iron binding protein

SCOPe Domain Sequences for d1mrpa_:

Sequence; same for both SEQRES and ATOM records:

>d1mrpa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]}
ditvyngqhkeaatavakafeqetgikvtlnsgkseqlagqlkeegdktpadvfyteqta
tfadlseagllapiseqtiqqtaqkgvplapkkdwialsgrsrvvvydhtklsekdmeks
vldyatpkwkgkigyvstsgafleqvvalskmkgdkvalnwlkglkengklyaknsvalq
avengevpaalinnyywynlakekgvenlksrlyfvrhqdpgalvsysgaavlkasknqa
eaqkfvdflaskkgqealvaaraeyplradvvspfnlepyekleapvvsattaqdkehai
klieeaglk

Timeline for d1mrpa_:

• d1mrpa_ first appeared (with stable ids) in SCOP 1.55, called d1mrp__
  
• d1mrpa_ appears in SCOPe 2.07