Lineage for d6b2ja1 (6b2j A:1-147)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2326304Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2326305Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2326306Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2326345Protein HIV-1 capsid protein [47945] (1 species)
  7. 2326346Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (62 PDB entries)
  8. 3057896Domain d6b2ja1: 6b2j A:1-147 [357958]
    Other proteins in same PDB: d6b2ja2
    automated match to d4xfxa1
    complexed with cl, iod; mutant

Details for d6b2ja1

PDB Entry: 6b2j (more details), 2.21 Å

PDB Description: e45a mutant of hiv-1 capsid protein (other crystal form)
PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d6b2ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b2ja1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsagatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d6b2ja1:

Click to download the PDB-style file with coordinates for d6b2ja1.
(The format of our PDB-style files is described here.)

Timeline for d6b2ja1:

  • d6b2ja1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-26

View in 3D
Domains from same chain:
(mouse over for more information)
d6b2ja2