Lineage for d6b2ja1 (6b2j A:1-147)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
core: 5 helices; bundleSuperfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) 
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) 
Protein HIV-1 capsid protein [47945] (1 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries) 
Domain d6b2ja1: 6b2j A:1-147 [357958]
Other proteins in same PDB: d6b2ja2
automated match to d4xfxa1
complexed with cl, iod; mutant
Details for d6b2ja1
PDB Entry: 6b2j (more details), 2.21 Å
PDB Description: e45a mutant of hiv-1 capsid protein (other crystal form)
PDB Compounds: (A:) hiv-1 capsid proteinSCOPe Domain Sequences for d6b2ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b2ja1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsagatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp
SCOPe Domain Coordinates for d6b2ja1:
Click to download the PDB-style file with coordinates for d6b2ja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6b2ja1:
- d6b2ja1 first appeared in SCOPe 2.07
View in 3D
