SCOPe 2.07: Domain d5ycjb_: 5ycj B:

Lineage for d5ycjb_ (5ycj B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (44 species)
   not a true protein

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [188226] (7 PDB entries)

8. Domain d5ycjb_: 5ycj B: [357942]
   automated match to d4pnja_
   complexed with hem, imd

Details for d5ycjb_

PDB Entry: 5ycj, 1.58 Å

PDB Description: ancestral myoglobin ambwb' of basilosaurus relative (polyphyly) imidazole-ligand

PDB Compounds: (B:) Ancestral myoglobin aMbWb' of Basilosaurus relative (polyphyly)

SCOPe Domain Sequences for d5ycjb_:

Sequence; same for both SEQRES and ATOM records:

>d5ycjb_ a.1.1.2 (B:) automated matches {Sperm whale (Physeter catodon) [TaxId: 9755]}
gshmglsdgewqlvlniwgkveadvaghgqdvlirlfkghpetlekfdkfkhlkteaemk
asedlkkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlh
srhpgdfgadaqgamnkalelfrkdiaakykelgfqg

Timeline for d5ycjb_:

• d5ycjb_ is new in SCOPe 2.07-stable
  
• d5ycjb_ appears in the current release, SCOPe 2.08, called d5ycjb1