Lineage for d5yrvk1 (5yrv K:46-224)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459598Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2459777Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) (S)
  5. 2459778Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
    contains additional structures in the C-terminal extension
  6. 2459779Protein Diol dehydratase, beta subunit [52970] (2 species)
  7. 2459780Species Klebsiella oxytoca [TaxId:571] [52971] (11 PDB entries)
  8. 3057871Domain d5yrvk1: 5yrv K:46-224 [357933]
    Other proteins in same PDB: d5yrva_, d5yrvb2, d5yrvc_, d5yrvd_, d5yrvf_, d5yrvg_, d5yrvi_, d5yrvj_, d5yrvk2, d5yrvl_
    automated match to d3auje_
    complexed with 5ad, b12, ca, cl, k, pgo

Details for d5yrvk1

PDB Entry: 5yrv (more details), 1.55 Å

PDB Description: diol dehydratase, adocbl/1,2-propanediol, anaerobically-prepared crystal
PDB Compounds: (K:) diol dehydrase beta subunit

SCOPe Domain Sequences for d5yrvk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yrvk1 c.51.3.1 (K:46-224) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]}
gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrval

SCOPe Domain Coordinates for d5yrvk1:

Click to download the PDB-style file with coordinates for d5yrvk1.
(The format of our PDB-style files is described here.)

Timeline for d5yrvk1:

  • d5yrvk1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20