Lineage for d5yrvd_ (5yrv D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2425286Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2425331Family c.1.19.3: Diol dehydratase, alpha subunit [51710] (2 proteins)
    automatically mapped to Pfam PF02286
  6. 2425332Protein Diol dehydratase, alpha subunit [51711] (2 species)
  7. 2425333Species Klebsiella oxytoca [TaxId:571] [51712] (10 PDB entries)
  8. 3057866Domain d5yrvd_: 5yrv D: [357928]
    Other proteins in same PDB: d5yrvb1, d5yrvb2, d5yrvc_, d5yrve_, d5yrvf_, d5yrvh_, d5yrvi_, d5yrvk1, d5yrvk2, d5yrvl_
    automated match to d1egva_
    complexed with 5ad, b12, ca, cl, k, pgo

Details for d5yrvd_

PDB Entry: 5yrv (more details), 1.55 Å

PDB Description: diol dehydratase, adocbl/1,2-propanediol, anaerobically-prepared crystal
PDB Compounds: (D:) diol dehydrase alpha subunit

SCOPe Domain Sequences for d5yrvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yrvd_ c.1.19.3 (D:) Diol dehydratase, alpha subunit {Klebsiella oxytoca [TaxId: 571]}
mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
iknipgaldpn

SCOPe Domain Coordinates for d5yrvd_:

Click to download the PDB-style file with coordinates for d5yrvd_.
(The format of our PDB-style files is described here.)

Timeline for d5yrvd_:

  • d5yrvd_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20