Lineage for d5ysca_ (5ysc A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912356Family c.92.2.2: TroA-like [53811] (6 proteins)
  6. 2912374Protein Vitamin B12 binding protein BtuF [82557] (2 species)
  7. 2912383Species Vibrio cholerae [TaxId:345073] [419779] (1 PDB entry)
  8. 2912384Domain d5ysca_: 5ysc A: [357916]
    automated match to d5m34a_
    complexed with cnc, so4

Details for d5ysca_

PDB Entry: 5ysc (more details), 1.67 Å

PDB Description: crystal structure of periplasmic vitamin b12 binding protein btuf of vibrio cholerae
PDB Compounds: (A:) Vitamin B12-binding protein

SCOPe Domain Sequences for d5ysca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ysca_ c.92.2.2 (A:) Vitamin B12 binding protein BtuF {Vibrio cholerae [TaxId: 345073]}
pfpaeriislaphateiayaaglgdklvavseysdyppqalelervanhqtiniekiltl
kpdliiawpagnpprelaklrqlgftiydsqtktldeiadniealshysanpevgqkaah
dfrqrlqdlrtqyasnqpiryfyqlsekpiitlaqghwpsevfslcggvnifadsevpyp
qvsieqvlvkqpqviftsehaianghmwrawqaelsavqndqvwalnadwlnrptprtld
aveqvctylkiaqkq

SCOPe Domain Coordinates for d5ysca_:

Click to download the PDB-style file with coordinates for d5ysca_.
(The format of our PDB-style files is described here.)

Timeline for d5ysca_: