Lineage for d6dtsa1 (6dts A:5-377)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (147 species)
    not a true protein
  7. 2488182Species Thermotoga maritima [TaxId:243274] [187721] (10 PDB entries)
  8. 3057848Domain d6dtsa1: 6dts A:5-377 [357910]
    Other proteins in same PDB: d6dtsa2, d6dtsb2
    automated match to d4glia_
    complexed with mtt

Details for d6dtsa1

PDB Entry: 6dts (more details), 1.5 Å

PDB Description: maltotetraose bound t. maritima male2
PDB Compounds: (A:) maltose-binding protein MalE2

SCOPe Domain Sequences for d6dtsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dtsa1 c.94.1.0 (A:5-377) automated matches {Thermotoga maritima [TaxId: 243274]}
tkltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiivga
hdwvgelavngliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyvds
vpktmdeliekakqideeyggevrgfiydvanfyfsapfilgyggyvfketpqgldvtdi
glanegavkgaklikrmidegvltpgdnygtmdsmfkeglaamiinglwaiksykdagin
ygvapipelepgvpakpfvgvqgfminakspnkviamefltnfiarketmykiyladprl
parkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdalsiiingqasvedal
keavekikaqiek

SCOPe Domain Coordinates for d6dtsa1:

Click to download the PDB-style file with coordinates for d6dtsa1.
(The format of our PDB-style files is described here.)

Timeline for d6dtsa1:

  • d6dtsa1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20

View in 3D
Domains from same chain:
(mouse over for more information)
d6dtsa2