Lineage for d6d5oa_ (6d5o A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529000Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2529014Protein Thermolysin [63414] (3 species)
  7. 2529015Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (180 PDB entries)
    Uniprot P00800
  8. 3057847Domain d6d5oa_: 6d5o A: [357909]
    automated match to d1kkka_
    complexed with ca, dmf, lys, val, zn

Details for d6d5oa_

PDB Entry: 6d5o (more details), 2 Å

PDB Description: hexagonal thermolysin (295 k) in the presence of 50% dmf
PDB Compounds: (A:) thermolysin

SCOPe Domain Sequences for d6d5oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d5oa_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

SCOPe Domain Coordinates for d6d5oa_:

Click to download the PDB-style file with coordinates for d6d5oa_.
(The format of our PDB-style files is described here.)

Timeline for d6d5oa_:

  • d6d5oa_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20