Lineage for d5z3mb_ (5z3m B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454323Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2454324Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2454393Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2454394Protein automated matches [190574] (17 species)
    not a true protein
  7. 2454459Species Vibrio cholerae [TaxId:345073] [257854] (2 PDB entries)
  8. 3057838Domain d5z3mb_: 5z3m B: [357900]
    automated match to d1u2qa_
    complexed with gol, mpo, so4

Details for d5z3mb_

PDB Entry: 5z3m (more details), 2.6 Å

PDB Description: crystal structure of low molecular weight phosphotyrosine phosphatase (vclmwptp-2) from vibrio choleraeo395
PDB Compounds: (B:) Phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d5z3mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z3mb_ c.44.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 345073]}
glsvlvvctgnlcrspmaeiilrdkirqkrlniqvrsagtlktgktmpddkalqalqdyg
yhpmvnpvqqvtqqdfiehdfiyamdrtnladlldicpaehknklalflskanrqekevp
dpyrrsseffqrtalliesgavalvdswqeqg

SCOPe Domain Coordinates for d5z3mb_:

Click to download the PDB-style file with coordinates for d5z3mb_.
(The format of our PDB-style files is described here.)

Timeline for d5z3mb_:

  • d5z3mb_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20