Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein D-maltodextrin-binding protein, MBP [53862] (5 species) contains a few additional helices in the C-terminal extension; homologous to thiaminase I |
Species Escherichia coli [TaxId:562] [53863] (47 PDB entries) Uniprot P02928 |
Domain d1mg1a1: 1mg1 A:6-370 [35790] Other proteins in same PDB: d1mg1a2 chimera with HTLV-1 gp21 ectodomain complexed with cl, mal |
PDB Entry: 1mg1 (more details), 2.5 Å
SCOPe Domain Sequences for d1mg1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mg1a1 c.94.1.1 (A:6-370) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} gklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwah drfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpn ppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvd nagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygv tvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgaval ksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaalaaa qtnaa
Timeline for d1mg1a1: