Lineage for d5yeeb2 (5yee B:147-375)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2460926Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2460927Protein Actin [53073] (9 species)
  7. 2460953Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (65 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 3057829Domain d5yeeb2: 5yee B:147-375 [357891]
    automated match to d1esva2
    complexed with atp, lab, mg

Details for d5yeeb2

PDB Entry: 5yee (more details), 1.81 Å

PDB Description: crystal structure of lokiprofilin1/rabbit actin complex
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d5yeeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yeeb2 c.55.1.1 (B:147-375) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

SCOPe Domain Coordinates for d5yeeb2:

Click to download the PDB-style file with coordinates for d5yeeb2.
(The format of our PDB-style files is described here.)

Timeline for d5yeeb2:

  • d5yeeb2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20