Lineage for d5zjba_ (5zjb A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2414536Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2414537Protein automated matches [190292] (37 species)
    not a true protein
  7. 3057816Species Vibrio mimicus [TaxId:674] [357878] (1 PDB entry)
  8. 3057817Domain d5zjba_: 5zjb A: [357879]
    automated match to d1yxya1
    complexed with mli, peg

Details for d5zjba_

PDB Entry: 5zjb (more details), 1.7 Å

PDB Description: structure of n-acetylmannosamine-6-phosphate-2-epimerase from vibrio cholerae
PDB Compounds: (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase

SCOPe Domain Sequences for d5zjba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zjba_ c.1.2.0 (A:) automated matches {Vibrio mimicus [TaxId: 674]}
knflnieelkrflngqtvvsiqpvtgspldktdfivamaiaveqagakalriegvsnvaa
vsaavtipiigivkrdlpdspvritpfvsdvdglanagatviafdatnrtrpesreriaq
aikntgcfamadcstfedglwansqgveivgstlsgyvgdieptvpdfqlvkafseagff
tmaegryntpelaakaiesgavavtvgsaltrlevvtqwfnnatqaagerkc

SCOPe Domain Coordinates for d5zjba_:

Click to download the PDB-style file with coordinates for d5zjba_.
(The format of our PDB-style files is described here.)

Timeline for d5zjba_:

  • d5zjba_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20