Lineage for d6d5ms_ (6d5m S:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332645Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 2332646Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 2332647Family a.117.1.1: Ras GEF [48367] (2 proteins)
  6. 2332648Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. 2332649Species Human (Homo sapiens) [TaxId:9606] [48369] (25 PDB entries)
    Uniprot Q07889 189-1046
  8. 3057813Domain d6d5ms_: 6d5m S: [357875]
    Other proteins in same PDB: d6d5mq_, d6d5mr1, d6d5mr2
    automated match to d1nvus_
    complexed with fw4, gnp, mg

Details for d6d5ms_

PDB Entry: 6d5m (more details), 2.08 Å

PDB Description: ras:sos:ras in complex with a small molecule activator
PDB Compounds: (S:) Son of sevenless homolog 1

SCOPe Domain Sequences for d6d5ms_:

Sequence, based on SEQRES records: (download)

>d6d5ms_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp
r

Sequence, based on observed residues (ATOM records): (download)

>d6d5ms_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtfltty
rsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvln
vcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkianitfqssp
ptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeins
pnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsam
nsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnil
kteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmg
nsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr

SCOPe Domain Coordinates for d6d5ms_:

Click to download the PDB-style file with coordinates for d6d5ms_.
(The format of our PDB-style files is described here.)

Timeline for d6d5ms_:

  • d6d5ms_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20