Lineage for d5zjna_ (5zjn A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2414486Family c.1.2.5: NanE-like [117362] (1 protein)
    Pfam PF04131
  6. 2414487Protein Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE [117363] (3 species)
  7. 3057808Species Vibrio cholerae [TaxId:666] [357870] (1 PDB entry)
  8. 3057812Domain d5zjna_: 5zjn A: [357874]
    automated match to d1yxya1
    complexed with edo, lry, peg, pge

Details for d5zjna_

PDB Entry: 5zjn (more details), 2.66 Å

PDB Description: structure of n-acetylmannosamine-6-phosphate-2-epimerase from vibrio cholerae with n-acetylmannosamine-6-phosphate
PDB Compounds: (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase

SCOPe Domain Sequences for d5zjna_:

Sequence, based on SEQRES records: (download)

>d5zjna_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Vibrio cholerae [TaxId: 666]}
ieelkrflngqtvvsiqpvtgspldktdfivamaiaveqagakalriegvsnvaavsaav
tipiigivkrdlpdspvritpfvsdvdglanagatviafdatnrtrpesreriaqaiknt
gcfamadcstfedglwansqgveivgstlsgyvgdieptvpdfqlvkafseagfftmaeg
ryntpelaakaiesgavavtvgsaltrlevvtqwfnnatqaage

Sequence, based on observed residues (ATOM records): (download)

>d5zjna_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Vibrio cholerae [TaxId: 666]}
ieelkrflngqtvvsiqpvtgspldktdfivamaiaveqagakalriegvsnvaavsaav
tipiigivkrdlpdspvritpfvsdvdglanagatviafdatnrtrpesreriaqaiknt
gcfamadcstfedglwansqgveivgstlsgyvptvpdfqlvkafseagfftmaegrynt
pelaakaiesgavavtvgsaltrlevvtqwfnnatqaage

SCOPe Domain Coordinates for d5zjna_:

Click to download the PDB-style file with coordinates for d5zjna_.
(The format of our PDB-style files is described here.)

Timeline for d5zjna_:

  • d5zjna_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20