Lineage for d5y9za2 (5y9z A:76-199)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2322415Protein Class sigma GST [81351] (5 species)
  7. 2322455Species Norway rat (Rattus norvegicus) [TaxId:10116] [47630] (2 PDB entries)
    synonym: hematopoietic prostaglandin D synthase
  8. 3057803Domain d5y9za2: 5y9z A:76-199 [357865]
    Other proteins in same PDB: d5y9za1, d5y9zb1
    automated match to d1pd211
    complexed with dio, edo, gol, gsh, mg, pge

Details for d5y9za2

PDB Entry: 5y9z (more details), 1.09 Å

PDB Description: crystal structure of rat hematopoietic prostaglandin d synthase
PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d5y9za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y9za2 a.45.1.1 (A:76-199) Class sigma GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndlltrqaphllkdldtyl
gdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnkvqaipaisawilkrp
qtkl

SCOPe Domain Coordinates for d5y9za2:

Click to download the PDB-style file with coordinates for d5y9za2.
(The format of our PDB-style files is described here.)

Timeline for d5y9za2:

  • d5y9za2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20

View in 3D
Domains from same chain:
(mouse over for more information)
d5y9za1