Lineage for d6eewa_ (6eew A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (128 species)
    not a true protein
  7. 3057654Species Catharanthus roseus [TaxId:4058] [357716] (1 PDB entry)
  8. 3057789Domain d6eewa_: 6eew A: [357851]
    automated match to d3k40a_
    complexed with ca, trp

Details for d6eewa_

PDB Entry: 6eew (more details), 2.05 Å

PDB Description: crystal structure of catharanthus roseus tryptophan decarboxylase in complex with l-tryptophan
PDB Compounds: (A:) Aromatic-L-amino-acid decarboxylase

SCOPe Domain Sequences for d6eewa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eewa_ c.67.1.0 (A:) automated matches {Catharanthus roseus [TaxId: 4058]}
fkpleaeefrkqahrmvdfiadyyknvetypvlsevepgylrkripetapylpeplddim
kdiqkdiipgmtnwmspnfyaffpatvssaaflgemlstalnsvgftwvsspaatelemi
vmdwlaqilklpksfmfsgtgggviqnttsesilctiiaareraleklgpdsigklvcyg
sdqthtmfpktcklagiypnnirlipttvetdfgispqvlrkmveddvaagyvplflcat
lgttsttatdpvdslseianefgiwihvdaayagsacicpefrhyldgiervdslslsph
kwllayldctclwvkqphlllralttnpeylknkqsdldkvvdfknwqiatgrkfrslkl
wlilrsygvvnlqshirsdvamakmfeewvrsdsrfeivvprnfslvcfrlkpdvsslhv
eevnkklldmlnstgrvymthtivggiymlrlavgsslteehhvrrvwdliqkltddll

SCOPe Domain Coordinates for d6eewa_:

Click to download the PDB-style file with coordinates for d6eewa_.
(The format of our PDB-style files is described here.)

Timeline for d6eewa_:

  • d6eewa_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20