SCOPe 2.08: Domain d5wflb1: 5wfl B:325-612

Lineage for d5wflb1 (5wfl B:325-612)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.11: Kelch motif [117281] (2 families)

5. Family b.68.11.1: Kelch motif [117282] (2 proteins)
   Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)

6. Protein automated matches [190126] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193097] (24 PDB entries)

8. Domain d5wflb1: 5wfl B:325-612 [357842]
   Other proteins in same PDB: d5wflb2
   automated match to d2dyha_
   complexed with so4

Details for d5wflb1

PDB Entry: 5wfl, 1.93 Å

PDB Description: kelch domain of human keap1 in open unliganded conformation

PDB Compounds: (B:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d5wflb1:

Sequence; same for both SEQRES and ATOM records:

>d5wflb1 b.68.11.1 (B:325-612) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnsp
dgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsverye
perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamn
tirsgagvcvlhnciyaaggydgqdqlnsverydvatatwtfvapmkhrrsalgitvhqg
riyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavtmep

Timeline for d5wflb1:

• d5wflb1 first appeared in SCOPe 2.07