Lineage for d6m8oa_ (6m8o A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (73 species)
    not a true protein
  7. 2438931Species Staphylococcus aureus [TaxId:1280] [225365] (2 PDB entries)
  8. 3057774Domain d6m8oa_: 6m8o A: [357836]
    automated match to d3gwga_
    complexed with so4

Details for d6m8oa_

PDB Entry: 6m8o (more details), 2.5 Å

PDB Description: crystal structure of the receiver domain of lytr from staphylococcus aureus
PDB Compounds: (A:) DNA-binding response regulator

SCOPe Domain Sequences for d6m8oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m8oa_ c.23.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkaliiddeplarneltyllneiggfeeineaenvketleallinqydiifldvnlmden
gielgakiqkmkeppaiifatahdqyavqafelnatdyilkpfgqkrieqavnkvrat

SCOPe Domain Coordinates for d6m8oa_:

Click to download the PDB-style file with coordinates for d6m8oa_.
(The format of our PDB-style files is described here.)

Timeline for d6m8oa_:

  • d6m8oa_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20