Lineage for d5y9zb1 (5y9z B:2-75)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2455762Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2456272Protein Class sigma GST [81362] (5 species)
  7. 2456312Species Norway rat (Rattus norvegicus) [TaxId:10116] [52875] (2 PDB entries)
    synonym: hematopoietic prostaglandin D synthase
  8. 3057768Domain d5y9zb1: 5y9z B:2-75 [357830]
    Other proteins in same PDB: d5y9za2, d5y9zb2
    automated match to d1pd212
    complexed with dio, edo, gol, gsh, mg, pge

Details for d5y9zb1

PDB Entry: 5y9z (more details), 1.09 Å

PDB Description: crystal structure of rat hematopoietic prostaglandin d synthase
PDB Compounds: (B:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d5y9zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y9zb1 c.47.1.5 (B:2-75) Class sigma GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvlevegltl
hqslaiaryltknt

SCOPe Domain Coordinates for d5y9zb1:

Click to download the PDB-style file with coordinates for d5y9zb1.
(The format of our PDB-style files is described here.)

Timeline for d5y9zb1:

  • d5y9zb1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20

View in 3D
Domains from same chain:
(mouse over for more information)
d5y9zb2