Lineage for d6d5hb1 (6d5h B:566-1046)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332645Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 2332646Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 2332647Family a.117.1.1: Ras GEF [48367] (2 proteins)
  6. 2332648Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. 2332649Species Human (Homo sapiens) [TaxId:9606] [48369] (25 PDB entries)
    Uniprot Q07889 189-1046
  8. 3057754Domain d6d5hb1: 6d5h B:566-1046 [357816]
    Other proteins in same PDB: d6d5ha_, d6d5hb2, d6d5hc1, d6d5hc2
    automated match to d1nvus_
    complexed with cl, fmt, fv7, gnp, gol, mg

Details for d6d5hb1

PDB Entry: 6d5h (more details), 1.8 Å

PDB Description: ras:sos:ras in complex with a small molecule activator
PDB Compounds: (B:) Son of sevenless homolog 1

SCOPe Domain Sequences for d6d5hb1:

Sequence, based on SEQRES records: (download)

>d6d5hb1 a.117.1.1 (B:566-1046) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp
r

Sequence, based on observed residues (ATOM records): (download)

>d6d5hb1 a.117.1.1 (B:566-1046) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtfltty
rsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvln
vcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkianitfqssp
ptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeins
pnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsam
nsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnil
kteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmg
nsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr

SCOPe Domain Coordinates for d6d5hb1:

Click to download the PDB-style file with coordinates for d6d5hb1.
(The format of our PDB-style files is described here.)

Timeline for d6d5hb1:

  • d6d5hb1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20