Lineage for d6dtub_ (6dtu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916259Species Thermotoga maritima [TaxId:243274] [187721] (11 PDB entries)
  8. 2916265Domain d6dtub_: 6dtu B: [357809]
    Other proteins in same PDB: d6dtua2
    automated match to d2ghaa_
    complexed with glc

Details for d6dtub_

PDB Entry: 6dtu (more details), 1.5 Å

PDB Description: maltotetraose bound t. maritima male1
PDB Compounds: (B:) maltose-binding protein MalE1

SCOPe Domain Sequences for d6dtub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dtub_ c.94.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
mqpkltiwcsekqvdilqklgeefkakygvevevqyvnfqdikskfltaapegqgadiiv
gahdwvgelavngliepipnfsdlknfyetalnafsyggklygipyameaialiynkdyv
peppktmdelieiakqideefggevrgfitsaaefyyiapfifgyggyvfkqtekgldvn
diglanegaikgvkllkrlvdegildpsdnyqimdsmfregqaamiingpwaikaykdag
idygvapipdlepgvparpfvgvqgfmvnakspnkllaiefltsfiakketmyriylgdp
rlpsrkdvlelvkdnpdvvgftlsaangipmpnvpqmaavwaamndalnlvvngkatvee
alknaverikaqiq

SCOPe Domain Coordinates for d6dtub_:

Click to download the PDB-style file with coordinates for d6dtub_.
(The format of our PDB-style files is described here.)

Timeline for d6dtub_: