Lineage for d5xgkd2 (5xgk D:233-436)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2510574Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2510575Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2510736Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2510774Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. 2510806Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (6 PDB entries)
    Uniprot P93836 33-428 ! Uniprot P93836 63-459
  8. 3057746Domain d5xgkd2: 5xgk D:233-436 [357808]
    automated match to d1sp9a2
    complexed with act, fe, tyf

Details for d5xgkd2

PDB Entry: 5xgk (more details), 2.8 Å

PDB Description: crystal structure of arabidopsis thaliana 4-hydroxyphenylpyruvate dioxygenase (athppd) complexed with its substrate 4- hydroxyphenylpyruvate acid (hppa)
PDB Compounds: (D:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d5xgkd2:

Sequence, based on SEQRES records: (download)

>d5xgkd2 d.32.1.3 (D:233-436) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
elgpaltyvagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrks
qiqtylehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgd
vlsddqikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayq
sggcggfgkgnfselfksieeyek

Sequence, based on observed residues (ATOM records): (download)

>d5xgkd2 d.32.1.3 (D:233-436) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
elgpaltyvagftgfhqfaeftalnsavlasndemvllpinepvkrksqiqtylehnega
glqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikecee
lgilvdrddqgtllqiftkplgdrptifieiiqrvgcmqsggcggfgkgnfselfksiee
yek

SCOPe Domain Coordinates for d5xgkd2:

Click to download the PDB-style file with coordinates for d5xgkd2.
(The format of our PDB-style files is described here.)

Timeline for d5xgkd2:

  • d5xgkd2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20