Lineage for d5wfla_ (5wfl A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2399047Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2399048Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2399057Protein automated matches [190126] (2 species)
    not a true protein
  7. 2399058Species Human (Homo sapiens) [TaxId:9606] [193097] (15 PDB entries)
  8. 3057742Domain d5wfla_: 5wfl A: [357804]
    Other proteins in same PDB: d5wflb2
    automated match to d2dyha_
    complexed with so4

Details for d5wfla_

PDB Entry: 5wfl (more details), 1.93 Å

PDB Description: kelch domain of human keap1 in open unliganded conformation
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d5wfla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wfla_ b.68.11.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
liytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnspdg
ntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsveryepe
rdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamnti
rsgagvcvlhnciyaaggydgqdqlnsverydvatatwtfvapmkhrrsalgitvhqgri
yvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

SCOPe Domain Coordinates for d5wfla_:

Click to download the PDB-style file with coordinates for d5wfla_.
(The format of our PDB-style files is described here.)

Timeline for d5wfla_:

  • d5wfla_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20