Lineage for d5os9a_ (5os9 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412402Fold b.142: DNA-binding pseudobarrel domain [101935] (1 superfamily)
    core: barrel, open; n=7, S*=10; capped with helices at both ends; partial similarity to the AbrB/MazE/MraZ-like fold (89446)
  4. 2412403Superfamily b.142.1: DNA-binding pseudobarrel domain [101936] (2 families) (S)
  5. 2412409Family b.142.1.2: B3 DNA binding domain [117343] (3 proteins)
    Pfam PF02362
  6. 3057733Protein automated matches [357795] (1 species)
    not a true protein
  7. 3057734Species Arabidopsis thaliana [TaxId:3702] [357796] (1 PDB entry)
  8. 3057735Domain d5os9a_: 5os9 A: [357797]
    automated match to d1wida_

Details for d5os9a_

PDB Entry: 5os9 (more details), 1.8 Å

PDB Description: structure of the b3 dna-binding domain of nga1
PDB Compounds: (A:) B3 domain-containing transcription factor NGA1

SCOPe Domain Sequences for d5os9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5os9a_ b.142.1.2 (A:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
adrehmfdkvvtpsdvgklnrlvipkqhaerffpldsssnekglllnfedltgkswrfry
sywnssqsyvmtkgwsrfvkdkkldagdivsfqrcvgdsgrdsrlfidwrrrpkv

SCOPe Domain Coordinates for d5os9a_:

Click to download the PDB-style file with coordinates for d5os9a_.
(The format of our PDB-style files is described here.)

Timeline for d5os9a_:

  • d5os9a_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20

View in 3D
Domains from other chains:
(mouse over for more information)
d5os9b_