SCOPe 2.08: Domain d6mela2: 6mel A:123-289

Lineage for d6mela2 (6mel A:123-289)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.0: automated matches [227303] (1 protein)
   not a true family

6. Protein automated matches [227129] (4 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:197] [357784] (1 PDB entry)

8. Domain d6mela2: 6mel A:123-289 [357785]
   Other proteins in same PDB: d6mela1, d6mela3, d6melb1
   automated match to d2scua2
   complexed with cit, cl

Details for d6mela2

PDB Entry: 6mel, 2.06 Å

PDB Description: succinyl-coa synthase from campylobacter jejuni

PDB Compounds: (A:) Succinate--CoA ligase subunit alpha

SCOPe Domain Sequences for d6mela2:

Sequence; same for both SEQRES and ATOM records:

>d6mela2 c.23.4.0 (A:123-289) automated matches {Campylobacter jejuni [TaxId: 197]}
ncpgiitseecklgimpgfifkkgcvglisksgtltyeaanqvvqggygistavgiggdp
iiglaykellsefqkddetkaivmigeiggsleveaakfikeniskpvvafiagatapkg
krmghagaivgsadesaaakkealksygihvvdspaligeeiqkilg

Timeline for d6mela2:

• d6mela2 first appeared in SCOPe 2.07