Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) |
Family c.23.4.0: automated matches [227303] (1 protein) not a true family |
Protein automated matches [227129] (4 species) not a true protein |
Species Campylobacter jejuni [TaxId:197] [357784] (1 PDB entry) |
Domain d6mela2: 6mel A:123-289 [357785] Other proteins in same PDB: d6mela1, d6mela3, d6melb1 automated match to d2scua2 complexed with cit, cl |
PDB Entry: 6mel (more details), 2.06 Å
SCOPe Domain Sequences for d6mela2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mela2 c.23.4.0 (A:123-289) automated matches {Campylobacter jejuni [TaxId: 197]} ncpgiitseecklgimpgfifkkgcvglisksgtltyeaanqvvqggygistavgiggdp iiglaykellsefqkddetkaivmigeiggsleveaakfikeniskpvvafiagatapkg krmghagaivgsadesaaakkealksygihvvdspaligeeiqkilg
Timeline for d6mela2: