Lineage for d6mela2 (6mel A:123-289)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439017Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2439101Family c.23.4.0: automated matches [227303] (1 protein)
    not a true family
  6. 2439102Protein automated matches [227129] (4 species)
    not a true protein
  7. 3057722Species Campylobacter jejuni [TaxId:197] [357784] (1 PDB entry)
  8. 3057723Domain d6mela2: 6mel A:123-289 [357785]
    Other proteins in same PDB: d6mela1, d6mela3, d6melb1
    automated match to d2scua2
    complexed with cit, cl

Details for d6mela2

PDB Entry: 6mel (more details), 2.06 Å

PDB Description: succinyl-coa synthase from campylobacter jejuni
PDB Compounds: (A:) Succinate--CoA ligase subunit alpha

SCOPe Domain Sequences for d6mela2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mela2 c.23.4.0 (A:123-289) automated matches {Campylobacter jejuni [TaxId: 197]}
ncpgiitseecklgimpgfifkkgcvglisksgtltyeaanqvvqggygistavgiggdp
iiglaykellsefqkddetkaivmigeiggsleveaakfikeniskpvvafiagatapkg
krmghagaivgsadesaaakkealksygihvvdspaligeeiqkilg

SCOPe Domain Coordinates for d6mela2:

Click to download the PDB-style file with coordinates for d6mela2.
(The format of our PDB-style files is described here.)

Timeline for d6mela2:

  • d6mela2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20