Lineage for d6mela1 (6mel A:2-122)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (249 species)
    not a true protein
  7. 3057720Species Campylobacter jejuni [TaxId:197] [357782] (1 PDB entry)
  8. 3057721Domain d6mela1: 6mel A:2-122 [357783]
    Other proteins in same PDB: d6mela2, d6mela3, d6melb1, d6melb2
    automated match to d2nu8a1
    complexed with cit, cl

Details for d6mela1

PDB Entry: 6mel (more details), 2.06 Å

PDB Description: succinyl-coa synthase from campylobacter jejuni
PDB Compounds: (A:) Succinate--CoA ligase subunit alpha

SCOPe Domain Sequences for d6mela1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mela1 c.2.1.0 (A:2-122) automated matches {Campylobacter jejuni [TaxId: 197]}
silvnkntkvivqgftgkeatfhaeqcmaygtnivggitphkggqthlgkpvfdtvadav
katkadvslifvpafavgdsvieaadagiklavvitehtpvkdmmfakqyankkgmkiig
p

SCOPe Domain Coordinates for d6mela1:

Click to download the PDB-style file with coordinates for d6mela1.
(The format of our PDB-style files is described here.)

Timeline for d6mela1:

  • d6mela1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20