Lineage for d6melb2 (6mel B:239-386)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439017Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2439101Family c.23.4.0: automated matches [227303] (1 protein)
    not a true family
  6. 2439102Protein automated matches [227129] (4 species)
    not a true protein
  7. 3057712Species Campylobacter jejuni [TaxId:195099] [357774] (1 PDB entry)
  8. 3057713Domain d6melb2: 6mel B:239-386 [357775]
    Other proteins in same PDB: d6mela1, d6mela3, d6melb1
    automated match to d2nu8e1
    complexed with cit, cl

Details for d6melb2

PDB Entry: 6mel (more details), 2.06 Å

PDB Description: succinyl-coa synthase from campylobacter jejuni
PDB Compounds: (B:) Succinate--CoA ligase [ADP-forming] subunit beta

SCOPe Domain Sequences for d6melb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6melb2 c.23.4.0 (B:239-386) automated matches {Campylobacter jejuni [TaxId: 195099]}
npaereaaefglsyvkldgdvacmvngaglamatmdiinysgakpanfldvgggaspetv
akafeiilrdknvkvifinifggivrcdriangileatknvevnipivvrldgtnaaeak
tildnsnlknikaatnlkngaelvkslv

SCOPe Domain Coordinates for d6melb2:

Click to download the PDB-style file with coordinates for d6melb2.
(The format of our PDB-style files is described here.)

Timeline for d6melb2:

  • d6melb2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20