Lineage for d6melb1 (6mel B:1-238)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541793Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2541794Protein automated matches [226904] (37 species)
    not a true protein
  7. 3057710Species Campylobacter jejuni [TaxId:195099] [357772] (1 PDB entry)
  8. 3057711Domain d6melb1: 6mel B:1-238 [357773]
    Other proteins in same PDB: d6mela1, d6mela2, d6mela3, d6melb2
    automated match to d2nu8b2
    complexed with cit, cl

Details for d6melb1

PDB Entry: 6mel (more details), 2.06 Å

PDB Description: succinyl-coa synthase from campylobacter jejuni
PDB Compounds: (B:) Succinate--CoA ligase [ADP-forming] subunit beta

SCOPe Domain Sequences for d6melb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6melb1 d.142.1.0 (B:1-238) automated matches {Campylobacter jejuni [TaxId: 195099]}
mniheyqakaifvdngiptlkgkvafsvdeavanakelggsvwavkaqihaggrglgggv
kiaknldevkdyaskilgmnlvthqtgpegklvqklyiesganivkeyylailfnrmaeq
itiiasseggmdiekvakespekiakvgidpqigfkmfhglevarvlgldkdegkklism
iaklyklymdkdmnmleinpliktaegdfyaldakcsfddsalyrhpeiaelrdttee

SCOPe Domain Coordinates for d6melb1:

Click to download the PDB-style file with coordinates for d6melb1.
(The format of our PDB-style files is described here.)

Timeline for d6melb1:

  • d6melb1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20