Lineage for d6gfka_ (6gfk A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2470224Family c.66.1.54: Methyltransferase 10 domain [142651] (2 proteins)
    Pfam PF05971; DUF890
  6. 2470228Protein automated matches [190671] (1 species)
    not a true protein
  7. 2470229Species Human (Homo sapiens) [TaxId:9606] [187777] (2 PDB entries)
  8. 3057701Domain d6gfka_: 6gfk A: [357763]
    automated match to d2h00a1
    complexed with sah, so4

Details for d6gfka_

PDB Entry: 6gfk (more details), 2.3 Å

PDB Description: delta-n mettl16 mtase domain
PDB Compounds: (A:) U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase

SCOPe Domain Sequences for d6gfka_:

Sequence, based on SEQRES records: (download)

>d6gfka_ c.66.1.54 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvslnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdsdk
stlrrgidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkv
pqktllmdalkeeseiiydfcmcnppffanqleakgvnsrnprrpppssvntggiteima
eggelefvkriihdslqlkkrlrwyscmlgkkcslaplkeelriqgvpkvtytefcqgrt
mrwalawsfyd

Sequence, based on observed residues (ATOM records): (download)

>d6gfka_ c.66.1.54 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvslnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdsdk
stlrrgidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkv
pqktllmdalkeeseiiydfcmcnppffanqggiteimaeggelefvkriihdslqlkkr
lrwyscmlgkkcslaplkeelriqgvpkvtytefcqgrtmrwalawsfyd

SCOPe Domain Coordinates for d6gfka_:

Click to download the PDB-style file with coordinates for d6gfka_.
(The format of our PDB-style files is described here.)

Timeline for d6gfka_:

  • d6gfka_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20