Lineage for d6ebob_ (6ebo B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314636Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2314637Protein automated matches [190036] (45 species)
    not a true protein
  7. 3057645Species Aerococcus urinae [TaxId:866775] [357707] (3 PDB entries)
  8. 3057687Domain d6ebob_: 6ebo B: [357749]
    automated match to d1oquc_
    complexed with ca, gol

Details for d6ebob_

PDB Entry: 6ebo (more details), 1.58 Å

PDB Description: crystal structure of the class ie riboucleotide reductase beta subunit from aerococcus urinae in unactivated form
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase, beta subunit

SCOPe Domain Sequences for d6ebob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ebob_ a.25.1.0 (B:) automated matches {Aerococcus urinae [TaxId: 866775]}
nyydrsvspveyayfdqsqnmrainwnkivdekdlevwnrvtqnfwlpenipvsndlpsw
neldddwqqlitrtftgltlldtvqssigdvaqiknslteqeqviyanfafmvgvharsy
gtifstlctseqieeahewvvdnealqarpkalipfytaddplkskiaaalmpgfllygg
fylpfylsargklpntsdiirlilrdkvihnfysgykyqlkvaklspekqaemkqfvfdl
ldkmiglektylhqlydgfgladeairfslynagkflqnlgyespftkeetriapevfaq
lsa

SCOPe Domain Coordinates for d6ebob_:

Click to download the PDB-style file with coordinates for d6ebob_.
(The format of our PDB-style files is described here.)

Timeline for d6ebob_:

  • d6ebob_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20