Lineage for d6gqja_ (6gqj A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (17 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (660 PDB entries)
  8. 3057686Domain d6gqja_: 6gqj A: [357748]
    automated match to d1t45a_
    complexed with f82

Details for d6gqja_

PDB Entry: 6gqj (more details), 2.33 Å

PDB Description: crystal structure of human c-kit kinase domain in complex with azd3229-analogue (compound 18)
PDB Compounds: (A:) Mast/stem cell growth factor receptor Kit

SCOPe Domain Sequences for d6gqja_:

Sequence, based on SEQRES records: (download)

>d6gqja_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nysyidptqlpydhkwefprnrlsfgktlgagafgkvveataqgliksdaamtvavkmlk
psahsterealmselkvlsylgnhenivnllgacthggptlviteyccygdllnflrrkr
defvpykvapedlykdfltlehllsfsyqvakgmaflaskncihrdlaarnillthgnit
kicdfglardikndsnyvdkgnarlpvkwmapesifnsvytfesdvwsygiflwelfslg
sspypgmpvdskfykmikegfrmsspeyapaemydimktcwdadpdkrptfkqivqdiek
qises

Sequence, based on observed residues (ATOM records): (download)

>d6gqja_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nysyidptqlpydhkwefprnrlsfgktlgagafgkvveataqgliksdaamtvavkmlk
psahsterealmselkvlsylgnhenivnllgacthggptlviteyccygdllnflrrkr
defvpykkdfltlehllsfsyqvakgmaflaskncihrdlaarnillthgnitkicdfgl
ardikndsnyvdkgnarlpvkwmapesifnsvytfesdvwsygiflwelfslgsspypgm
pvdskfykmikegfrmsspeyapaemydimktcwdadpdkrptfkqivqdiekqises

SCOPe Domain Coordinates for d6gqja_:

Click to download the PDB-style file with coordinates for d6gqja_.
(The format of our PDB-style files is described here.)

Timeline for d6gqja_:

  • d6gqja_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20