SCOPe 2.08: Domain d6gbxb_: 6gbx B:

Lineage for d6gbxb_ (6gbx B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.8: Glutaminyl-peptide cyclotransferase-like [142532] (1 protein)
   part of Pfam PF04389

6. Protein Glutaminyl-peptide cyclotransferase, QPCT [142533] (2 species)
   Glutaminyl cyclase

7. Species Human (Homo sapiens) [TaxId:9606] [142534] (29 PDB entries)
   Uniprot Q16769 33-361

8. Domain d6gbxb_: 6gbx B: [357742]
   automated match to d3pbea_
   complexed with edo, s77, so4, zn

Details for d6gbxb_

PDB Entry: 6gbx, 1.72 Å

PDB Description: crystal structure of human glutaminyl cyclase variant y115e-y117e in complex with sen177

PDB Compounds: (B:) Glutaminyl-peptide cyclotransferase

SCOPe Domain Sequences for d6gbxb_:

Sequence; same for both SEQRES and ATOM records:

>d6gbxb_ c.56.5.8 (B:) Glutaminyl-peptide cyclotransferase, QPCT {Human (Homo sapiens) [TaxId: 9606]}
sawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhimq
riqrlqadwvleidtflsqtpegersfsniistlnptakrhlvlachydskyfshwnnrv
fvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqdsl
ygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqa
iehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmd
dneenldestidnlnkilqvfvleylhl

Timeline for d6gbxb_:

• d6gbxb_ first appeared in SCOPe 2.07