Lineage for d6eema_ (6eem A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (128 species)
    not a true protein
  7. 3057671Species Papaver somniferum [TaxId:3469] [357733] (1 PDB entry)
  8. 3057672Domain d6eema_: 6eem A: [357734]
    automated match to d3rcha_
    complexed with 0pr, so4, tyr

Details for d6eema_

PDB Entry: 6eem (more details), 2.61 Å

PDB Description: crystal structure of papaver somniferum tyrosine decarboxylase in complex with l-tyrosine
PDB Compounds: (A:) Tyrosine/dopa decarboxylase

SCOPe Domain Sequences for d6eema_:

Sequence, based on SEQRES records: (download)

>d6eema_ c.67.1.0 (A:) automated matches {Papaver somniferum [TaxId: 3469]}
qnpldpdefrrqghmiidfladyyknvekypvrsqvepgylkkrlpesapynpesietil
edvtndiipglthwqspnyfayfpssgsiagflgemlstgfnvvgfnwmsspaatelesi
vmnwlgqmltlpksflfssdgssggggvlqgttceailctltaardkmlnkigreninkl
vvyasdqthcalqkaaqiaginpknvraiktskatnfglspnslqsailadiesglvplf
lcatvgttsstavdpigplcavaklygiwvhidaayagsacicpefrhfidgvedadsfs
lnahkwffttldccclwvkdsdslvkalstspeylknkateskqvidykdwqialsrrfr
smklwlvlrsygvanlrtflrshvkmakhfqgligmdnrfeivvprtfamvcfrlkptai
fkqkivdndyiedqtnevnvkllesvnasgkiymthavvggvymirfavgatlteerhvt
gawkvvqehtdailg

Sequence, based on observed residues (ATOM records): (download)

>d6eema_ c.67.1.0 (A:) automated matches {Papaver somniferum [TaxId: 3469]}
qnpldpdefrrqghmiidfladyyknvekypvrsqvepgylkkrlpesapynpesietil
edvtndiipglthwqspnyfayfpssgsiagflgemlstgfnvvgfnwmsspaatelesi
vmnwlgqmltlpksflfssdgggggvlqgttceailctltaardkmlnkigreninklvv
yasdqthcalqkaaqiaginpknvraiktskatnfglspnslqsailadiesglvplflc
atvgttsstavdpigplcavaklygiwvhidaayagsacicpefrhfidgvedadsfsln
ahkwffttldccclwvkdsdslvkalstspeylknqvidykdwqialsrrfrsmklwlvl
rsygvanlrtflrshvkmakhfqgligmdnrfeivvprtfamvcfrlkptaifkqkivdn
dyiedqtnevnvkllesvnasgkiymthavvggvymirfavgatlteerhvtgawkvvqe
htdailg

SCOPe Domain Coordinates for d6eema_:

Click to download the PDB-style file with coordinates for d6eema_.
(The format of our PDB-style files is described here.)

Timeline for d6eema_:

  • d6eema_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20