Lineage for d6dmxb_ (6dmx B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309862Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily)
    3 helices; bundle, partly opened
  4. 2309863Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) (S)
    automatically mapped to Pfam PF02172
  5. 2309864Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein)
  6. 2309865Protein Kix domain of CBP (creb binding protein) [47042] (1 species)
  7. 2309866Species Mouse (Mus musculus) [TaxId:10090] [47043] (13 PDB entries)
  8. 3057660Domain d6dmxb_: 6dmx B: [357722]
    automated match to d5u4ka_

Details for d6dmxb_

PDB Entry: 6dmx (more details), 2.8 Å

PDB Description: hbz56 in complex with kix and c-myb
PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d6dmxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dmxb_ a.12.1.1 (B:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]}
kgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesansrde
yyhllaekiykiqkeleekrrsrl

SCOPe Domain Coordinates for d6dmxb_:

Click to download the PDB-style file with coordinates for d6dmxb_.
(The format of our PDB-style files is described here.)

Timeline for d6dmxb_:

  • d6dmxb_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20