Lineage for d6ebpd_ (6ebp D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2703901Species Aerococcus urinae [TaxId:866775] [357707] (3 PDB entries)
  8. 2703909Domain d6ebpd_: 6ebp D: [357708]
    automated match to d1oquc_
    complexed with ca, dah, gol

Details for d6ebpd_

PDB Entry: 6ebp (more details), 1.59 Å

PDB Description: crystal structure of the class ie ribonucleotide reductase beta subunit from aerococcus urinae in activated form
PDB Compounds: (D:) Ribonucleoside-diphosphate reductase, beta subunit

SCOPe Domain Sequences for d6ebpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ebpd_ a.25.1.0 (D:) automated matches {Aerococcus urinae [TaxId: 866775]}
nyydrsvspveyayfdqsqnmrainwnkivdekdlevwnrvtqnfwlpenipvsndlpsw
neldddwqqlitrtftgltlldtvqssigdvaqiknslteqeqviyanfafmvgvharsf
gtifstlctseqieeahewvvdnealqarpkalipfytaddplkskiaaalmpgfllygg
fylpfylsargklpntsdiirlilrdkvihnfysgykyqlkvaklspekqaemkqfvfdl
ldkmiglektylhqlydgfgladeairfslynagkflqnlgyespftkeetriapevfaq
lsaradenhdf

SCOPe Domain Coordinates for d6ebpd_:

Click to download the PDB-style file with coordinates for d6ebpd_.
(The format of our PDB-style files is described here.)

Timeline for d6ebpd_: