Lineage for d6a67l2 (6a67 L:113-214)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 3057607Domain d6a67l2: 6a67 L:113-214 [357669]
    Other proteins in same PDB: d6a67d1, d6a67l1
    automated match to d2fb4l2
    complexed with nag

Details for d6a67l2

PDB Entry: 6a67 (more details), 2.33 Å

PDB Description: crystal structure of influenza a virus h5 hemagglutinin globular head in complex with the fab of antibody fld21.140
PDB Compounds: (L:) FLD21.140 Light Chain

SCOPe Domain Sequences for d6a67l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a67l2 b.1.1.2 (L:113-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d6a67l2:

Click to download the PDB-style file with coordinates for d6a67l2.
(The format of our PDB-style files is described here.)

Timeline for d6a67l2:

  • d6a67l2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20

View in 3D
Domains from same chain:
(mouse over for more information)
d6a67l1