Lineage for d6baka1 (6bak A:16-130)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534513Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2534777Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2535027Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2535028Protein automated matches [190492] (20 species)
    not a true protein
  7. 2535134Species Stigmatella aurantiaca [TaxId:378806] [317293] (4 PDB entries)
  8. 3057596Domain d6baka1: 6bak A:16-130 [357658]
    Other proteins in same PDB: d6baka2
    automated match to d4rq9a1
    complexed with blr; mutant

Details for d6baka1

PDB Entry: 6bak (more details), 1.92 Å

PDB Description: the structure of the stigmatella aurantiaca phytochrome chromophore binding domain t289h mutant
PDB Compounds: (A:) Photoreceptor-histidine kinase BphP

SCOPe Domain Sequences for d6baka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6baka1 d.110.3.0 (A:16-130) automated matches {Stigmatella aurantiaca [TaxId: 378806]}
tncdrepihipgaiqphgvllvlsepglvlthasenapavlgnsaeqllgaplghfieps
vrepleadlrsarlkqlnplkvvwrvdgvdrffdgiahrhqgrlilelepsshre

SCOPe Domain Coordinates for d6baka1:

Click to download the PDB-style file with coordinates for d6baka1.
(The format of our PDB-style files is described here.)

Timeline for d6baka1:

  • d6baka1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20

View in 3D
Domains from same chain:
(mouse over for more information)
d6baka2