SCOPe 2.08: Domain d6bafa1: 6baf A:16-130

Lineage for d6bafa1 (6baf A:16-130)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Stigmatella aurantiaca [TaxId:378806] [317293] (3 PDB entries)

8. Domain d6bafa1: 6baf A:16-130 [357657]
   Other proteins in same PDB: d6bafa2
   automated match to d4rq9a1
   complexed with blr

Details for d6bafa1

PDB Entry: 6baf, 1.85 Å

PDB Description: structure of the chromophore binding domain of stigmatella aurantiaca phytochrome p1, wild-type

PDB Compounds: (A:) Photoreceptor-histidine kinase BphP

SCOPe Domain Sequences for d6bafa1:

Sequence; same for both SEQRES and ATOM records:

>d6bafa1 d.110.3.0 (A:16-130) automated matches {Stigmatella aurantiaca [TaxId: 378806]}
tncdrepihipgaiqphgvllvlsepglvlthasenapavlgnsaeqllgaplghfieps
vrepleadlrsarlkqlnplkvvwrvdgvdrffdgiahrhqgrlilelepsshre

Timeline for d6bafa1:

• d6bafa1 first appeared in SCOPe 2.07