Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (24 species) not a true protein |
Species Stigmatella aurantiaca [TaxId:378806] [317293] (3 PDB entries) |
Domain d6bafa1: 6baf A:16-130 [357657] Other proteins in same PDB: d6bafa2 automated match to d4rq9a1 complexed with blr |
PDB Entry: 6baf (more details), 1.85 Å
SCOPe Domain Sequences for d6bafa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bafa1 d.110.3.0 (A:16-130) automated matches {Stigmatella aurantiaca [TaxId: 378806]} tncdrepihipgaiqphgvllvlsepglvlthasenapavlgnsaeqllgaplghfieps vrepleadlrsarlkqlnplkvvwrvdgvdrffdgiahrhqgrlilelepsshre
Timeline for d6bafa1: