Lineage for d6bjia1 (6bji A:64-344)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473281Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2473282Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2473713Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2473766Protein Glycosyltransferase A catalytic domain [75276] (1 species)
    involved in blood group antigen biosynthesis
  7. 2473767Species Human (Homo sapiens) [TaxId:9606] [75277] (54 PDB entries)
    Uniprot P16442 64-345
  8. 3057593Domain d6bjia1: 6bji A:64-344 [357655]
    Other proteins in same PDB: d6bjia2
    automated match to d1lzia_
    complexed with gol; mutant

Details for d6bjia1

PDB Entry: 6bji (more details), 1.54 Å

PDB Description: human abo(h) blood group glycosyltransferase gta d302c mutant
PDB Compounds: (A:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d6bjia1:

Sequence, based on SEQRES records: (download)

>d6bjia1 c.68.1.9 (A:64-344) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
ftyerrpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwhce
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftav

Sequence, based on observed residues (ATOM records): (download)

>d6bjia1 c.68.1.9 (A:64-344) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevrvsmrrme
misdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssreaftyerrp
qsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwhceshlnkyl
lrhkptkvlspeylwdqqllgwpavlrklrftav

SCOPe Domain Coordinates for d6bjia1:

Click to download the PDB-style file with coordinates for d6bjia1.
(The format of our PDB-style files is described here.)

Timeline for d6bjia1:

  • d6bjia1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20

View in 3D
Domains from same chain:
(mouse over for more information)
d6bjia2